RING Finger Protein Z, Recombinant, Lassa virus, aa2-99, His-Tag

Catalog Number: USB-586198
Article Name: RING Finger Protein Z, Recombinant, Lassa virus, aa2-99, His-Tag
Biozol Catalog Number: USB-586198
Supplier Catalog Number: 586198
Alternative Catalog Number: USB-586198-20,USB-586198-100
Manufacturer: US Biological
Category: Molekularbiologie
Plays a crucial role in virion assembly and budding. Expressed late in the virus life cycle, it acts as an inhibitor of viral transcription and RNA synthesis by interacting with the viral polymerase L. Presumably recruits the NP encapsidated genome to cellular membranes at budding sites via direct interaction with NP. Plays critical roles in the final steps of viral release by interacting with host TSG101, a member of the vacuolar protein-sorting pathway and using other cellular host proteins involved in vesicle formation pathway. The budding of the virus progeny occurs after association of protein Z with the viral glycoprotein complex SSP-GP1-GP2 at the cell periphery, step that requires myristoylation of protein Z. Also selectively represses protein production by associating with host eIF4E. Source: Recombinant protein corresponding to aa2-99 from Lassa virus RING finger protein Z fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~14.6kD Amino Acid Sequence: GNKQAKAPESKDSPRASLIPDATHLGPQFCKSCWFENKGLVECNNHYLCLNCLTLLLSVSNRCPICKMPLPTKLRPSAAPTAPPTGAADSIRPPPYSP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 14.6
UniProt: O73557
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.