RNA-binding Motif Protein, X Chromosome, Recombinant, Human, aa333-391, GST-Tag

Catalog Number: USB-586208
Article Name: RNA-binding Motif Protein, X Chromosome, Recombinant, Human, aa333-391, GST-Tag
Biozol Catalog Number: USB-586208
Supplier Catalog Number: 586208
Alternative Catalog Number: USB-586208-20,USB-586208-100
Manufacturer: US Biological
Category: Molekularbiologie
RNA-binding protein that plays several role in the regulation of pre- and post-transcriptional processes. Implicated in tissue-specific regulation of gene transcription and alternative splicing of several pre-mRNAs. Binds to and stimulates transcription from the tumor suppressor TXNIP gene promoter, may thus be involved in tumor suppression. When associated with SAFB, binds to and stimulates transcription from the SREBF1 promoter. Associates with nascent mRNAs transcribed by RNA polymerase II. Component of the supraspliceosome complex that regulates pre-mRNA alternative splice site selection. Can either activate or suppress exon inclusion, acts additively with TRA2B to promote exon 7 inclusion of the survival motor neuron SMN2. Represses the splicing of MAPT/Tau exon 10. Binds preferentially to single-stranded 5-CC[A/C]-rich RNA sequence motifs localized in a single-stranded conformation, probably binds RNA as a homodimer. Binds non-specifically to pre-mRNAs. Plays also a role in the cytoplasmic TNFR1 trafficking pathways, promotes both the IL-1-beta-mediated inducible proteolytic cleavage of TNFR1 ectodomains and the release of TNFR1 exosome-like vesicles to the extracellular compartment. Source: Recombinant protein corresponding to aa333-391 from human RNA-binding motif protein, X chromosome, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~33.4kD Amino Acid Sequence: DLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 33.4
UniProt: P38159
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.