S-layer Protein, Recombinant, Campylobacter fetus, aa1-268, His-Tag, Myc-Tag

Catalog Number: USB-586224
Article Name: S-layer Protein, Recombinant, Campylobacter fetus, aa1-268, His-Tag, Myc-Tag
Biozol Catalog Number: USB-586224
Supplier Catalog Number: 586224
Alternative Catalog Number: USB-586224-20,USB-586224-100
Manufacturer: US Biological
Category: Molekularbiologie
The S-layer is a paracrystalline mono-layered assembly of proteins which coats the surface of bacteria. This protein is critical for virulence. Source: Recombinant protein corresponding to aa1-268 from Campylobacter fetus S-layer protein, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~33.0kD Amino Acid Sequence: MLNKTDVSMLYITIMGMASEGDGNKYWLDYANNNSLGVSSLANIMLDSPGAAKFFGDSLLAGNEKDFVTKIYSIALGNTSDVDGINYWTKAITGGGEFTDSKGNVISVASLSKGDLIGAMINSMVNGGSAESKAIFEAKAAASDYFADATLVRDISGLDEGTTSKLISEINSASDLDKVKSEIDALKSELPNPGSTYDLTEGNDNLKGTDLDDTFNGTTYVGNGTNKSTLSAFDKIDGGAGRDTLNAIFTANNNAAAATKLDQAEIDK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 33
UniProt: P35827
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.