Saccharopepsin, Recombinant, Saccharomyces cerevisiae, aa77-405, His-Tag

Catalog Number: USB-586226
Article Name: Saccharopepsin, Recombinant, Saccharomyces cerevisiae, aa77-405, His-Tag
Biozol Catalog Number: USB-586226
Supplier Catalog Number: 586226
Alternative Catalog Number: USB-586226-20, USB-586226-100
Manufacturer: US Biological
Category: Molekularbiologie
Aspartyl protease implicated in the post-translational regulation of S.cerevisiae vacuolar proteinases. Acts on YSCB, on YSCY and on itself. Recombinant protein corresponding to aa77-405 from Saccharomyces cerevisiae Saccharopepsin, fused to 10X His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.4kD Amino Acid Sequence: GGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGIDESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLITLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVGLAKAI Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 39.4
UniProt: P07267
Purity: 85% (SDS-PAGE)
Form: Supplied as a liquid in Tris, pH 8.0, 50% glycerol