Saccharopepsin, Recombinant, Saccharomyces cerevisiae, aa77-405, His-Tag

Catalog Number: USB-586227
Article Name: Saccharopepsin, Recombinant, Saccharomyces cerevisiae, aa77-405, His-Tag
Biozol Catalog Number: USB-586227
Supplier Catalog Number: 586227
Alternative Catalog Number: USB-586227-20, USB-586227-100
Manufacturer: US Biological
Category: Molekularbiologie
Aspartyl protease implicated in the post-translational regulation of S.cerevisiae vacuolar proteinases. Acts on YSCB, on YSCY and on itself. Source: Recombinant protein corresponding to aa77-405 from Saccharomyces cerevisiae Saccharopepsin, fused to 10X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~38.2kD Amino Acid Sequence: GGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGIDESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLITLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVGLAKAI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 38.2
UniProt: P07267
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.