Sclerostin, Recombinant, Rat, aa29-213, hFc-Tag

Catalog Number: USB-586244
Article Name: Sclerostin, Recombinant, Rat, aa29-213, hFc-Tag
Biozol Catalog Number: USB-586244
Supplier Catalog Number: 586244
Alternative Catalog Number: USB-586244-20,USB-586244-100
Manufacturer: US Biological
Category: Molekularbiologie
Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation. Source: Recombinant protein corresponding to aa29-213 from rat Sclerostin, fused to hFc-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~50kD Amino Acid Sequence: FKNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 50
UniProt: Q99P67
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.