Scrapie-responsive Protein 1, Recombinant, Mouse, aa21-98, His-SUMO-Tag

Catalog Number: USB-586247
Article Name: Scrapie-responsive Protein 1, Recombinant, Mouse, aa21-98, His-SUMO-Tag
Biozol Catalog Number: USB-586247
Supplier Catalog Number: 586247
Alternative Catalog Number: USB-586247-20, USB-586247-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa21-322 from Neosartorya fumigata Allergen Asp f 4, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~25.0kD Amino Acid Sequence: MPSSRLSCYRKLLKDRNCHNLPEGRADLKLIDANVQHHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 25
UniProt: O88745
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.