Secreted Ly-6/uPAR-related Protein 1, Recombinant, Human, aa23-103

Catalog Number: USB-586250
Article Name: Secreted Ly-6/uPAR-related Protein 1, Recombinant, Human, aa23-103
Biozol Catalog Number: USB-586250
Supplier Catalog Number: 586250
Alternative Catalog Number: USB-586250-20,USB-586250-100
Manufacturer: US Biological
Category: Molekularbiologie
Has an antitumor activity. Was found to be a marker of late differentiation of the skin. Implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin. In vitro down-regulates keratinocyte proliferation, the function may involve the proposed role as modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-7-dependent nAChR currents in an allosteric manner. In T cells may be involved in regulation of intracellular Ca(2+) signaling. Seems to have an immunomodulatory function in the cornea. The function may implicate a possible role as a scavenger receptor for PLAU thereby blocking PLAU-dependent functions of PLAUR such as in cell migration and proliferation. Source: Recombinant protein corresponding to aa23-103 from human Secreted Ly-6/uPAR-related protein 1, expressed in E.coli. Molecular Weight: ~8.9kD Amino Acid Sequence: LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 8.9
UniProt: P55000
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.