Secreted Protein BARF1, Recombinant, Epstein-Barr virus, aa21-221, His-Tag, Myc-Tag

Product Overview

• Article Name: Secreted Protein BARF1, Recombinant, Epstein-Barr virus, aa21-221, His-Tag, Myc-Tag
• Biozol Catalog Number: USB-586256
• Supplier Catalog Number: 586256
• Alternative Catalog Number: USB-586256-20,USB-586256-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Plays diverse functions in immunomodulation and oncogenicity, maybe by acting as a functional receptor for human CSF1. May inhibit interferon secretion from mononuclear cells. Exhibits oncogenic activity in vitro. Source: Recombinant protein corresponding to aa21-221 from Epstein-Barr virus Secreted protein BARF1, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~29.9kD Amino Acid Sequence: VTAFLGERVTLTSYWRRVSLGPEIEVSWFKLGPGEEQVLIGRMHHDVIFIEWPFRGFFDIHRSANTFFLVVTAANISHDGNYLCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHVQWLMPEGVEPAPTAANGGVMKEKDGSLSVAVDLSLPKPWHLPVTCVGKNDKEEAHGVYVSGYLSQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 29.9
• UniProt: P03228
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.