Serine/arginine-rich Splicing Factor 3, Recombinant, Human, aa1-86, His-GB1-Tag

Catalog Number: USB-586279
Article Name: Serine/arginine-rich Splicing Factor 3, Recombinant, Human, aa1-86, His-GB1-Tag
Biozol Catalog Number: USB-586279
Supplier Catalog Number: 586279
Alternative Catalog Number: USB-586279-20,USB-586279-100
Manufacturer: US Biological
Category: Molekularbiologie
Splicing factor that specifically promotes exon-inclusion during alternative splicing. Interaction with YTHDC1, a RNA-binding protein that recognizes and binds N6-methyladenosine (m6A)-containing RNAs, promotes recruitment of SRSF3 to its mRNA-binding elements adjacent to m6A sites, leading to exon-inclusion during alternative splicing. Also functions as export adapter involved in mRNA nuclear export. Binds mRNA which is thought to be transferred to the NXF1-NXT1 heterodimer for export (TAP/NXF1 pathway), enhances NXF1-NXT1 RNA-binding activity. Involved in nuclear export of m6A-containing mRNAs via interaction with YTHDC1: interaction with YTHDC1 facilitates m6A-containing mRNA-binding to both SRSF3 and NXF1, promoting mRNA nuclear export. RNA-binding is semi-sequence specific. Source: Recombinant protein corresponding to aa1-86 from human Serine/arginine-rich splicing factor 3, fused to 6X His-GB1-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~17.9kD Amino Acid Sequence: MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 17.9
UniProt: P84103
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.