Serotype 3 Fimbrial Subunit, Recombinant, Bordetella pertussis, aa26-204, His-SUMO-Tag

Catalog Number: USB-586298
Article Name: Serotype 3 Fimbrial Subunit, Recombinant, Bordetella pertussis, aa26-204, His-SUMO-Tag
Biozol Catalog Number: USB-586298
Supplier Catalog Number: 586298
Alternative Catalog Number: USB-586298-20, USB-586298-100
Manufacturer: US Biological
Category: Molekularbiologie
Bordetella pertussis is the causative agent of whooping cough. An essential step in the disease process is the attachment of the bacteria to the ciliated epithelium of the respiratory tract, enabling the organism to resist normal host-clearance mechanisms. It is unclear which bacterial cell surface component are responsible for adherence but the fimbriae of B.pertussis are prime candidates for being involved in this process. Source: Recombinant protein corresponding to aa26-204 from Bordetella pertussis Serotype 3 fimbrial subunit, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~35.2kD Amino Acid Sequence: NDGTIVITGSISDQTCVIEEPSTLNHIKVVQLPKISKNALRNDGDTAGATPFDIKLKECPQALGALKLYFEPGITTNYDTGDLIAYKQTYNASGNGNLSTVSSATKAKGVEFRLANLNGQHIRMGTDKTTQAAQTFTGKVTNGSKSYTLRYLASYVKKPKEDVDAAQITSYVGFSVVYP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 35.2
UniProt: P17835
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.