Sialic Acid-binding Ig-like Lectin 15, Recombinant, Human, aa20-263, His-SUMO-Tag

Catalog Number: USB-586322
Article Name: Sialic Acid-binding Ig-like Lectin 15, Recombinant, Human, aa20-263, His-SUMO-Tag
Biozol Catalog Number: USB-586322
Supplier Catalog Number: 586322
Alternative Catalog Number: USB-586322-20, USB-586322-100
Manufacturer: US Biological
Category: Molekularbiologie
Binds sialylated glycoproteins. Source: Recombinant protein corresponding to aa20-263 from human Sialic acid-binding Ig-like lectin 15, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~42.6kD Amino Acid Sequence: FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 42.6
UniProt: Q6ZMC9
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.