Sialoadhesin, Recombinant, Porcine, aa20-153, His-Tag, Myc-Tag

Catalog Number: USB-586337
Article Name: Sialoadhesin, Recombinant, Porcine, aa20-153, His-Tag, Myc-Tag
Biozol Catalog Number: USB-586337
Supplier Catalog Number: 586337
Alternative Catalog Number: USB-586337-20,USB-586337-100
Manufacturer: US Biological
Category: Molekularbiologie
Macrophage-restricted adhesion molecule that mediates sialic-acid dependent binding to lymphocytes, including granulocytes, monocytes, natural killer cells, B-cells and CD8 T-cells. Preferentially binds to alpha-2,3-linked sialic acid. Binds to SPN/CD43 on T-cells. May play a role in hemopoiesis. Acts as an endocytic receptor mediating clathrin dependent endocytosis. In case of porcine reproductive and respiratory syndrome virus (PRRSV), mediates virion attachment and internalization into alveolar macrophages through a clathrin-coated dependent process. Source: Recombinant protein corresponding to aa20-153 from porcine Sialoadhesin, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~22.3kD Amino Acid Sequence: SWTVSRPETVQGIKGSCLIIPCTFGFPANVEVPHGITAIWYYDYSGKRLVVSHSRNPKVVENHFQGRALLLGQAEQRTCSLLLKDLQPQDSGSYNFRFEISEGNRWSDVKGTVVTVTEVPSVPTIALPAKLHEG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 22.3
UniProt: A7LCJ3
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.