Small Proline-rich Protein 2B, Recombinant, Mouse, aa1-98, His-Tag, Myc-Tag

Catalog Number: USB-586362
Article Name: Small Proline-rich Protein 2B, Recombinant, Mouse, aa1-98, His-Tag, Myc-Tag
Biozol Catalog Number: USB-586362
Supplier Catalog Number: 586362
Alternative Catalog Number: USB-586362-20
Manufacturer: US Biological
Category: Molekularbiologie
Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane (By similarity). Source: Recombinant protein corresponding to aa1-98 from mouse Small proline-rich protein 2B, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~14.7kD Amino Acid Sequence: MSYYQQQCKQPCQPPPVCPPPKCPEPCPPPKCPEPCPPPVCCEPCPPPKCPEPCPPPVCCEPCPPPVCCEPCPPQPWQPKCPPVQFPPCQQKCPPKNK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 14.7
UniProt: O70554
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.