Snake Venom Metalloproteinase Leucurolysin-A, Recombinant, Bothrops leucurus, aa1-202, His-Tag, Myc-Tag

Catalog Number: USB-586366
Article Name: Snake Venom Metalloproteinase Leucurolysin-A, Recombinant, Bothrops leucurus, aa1-202, His-Tag, Myc-Tag
Biozol Catalog Number: USB-586366
Supplier Catalog Number: 586366
Alternative Catalog Number: USB-586366-20, USB-586366-100
Manufacturer: US Biological
Category: Molekularbiologie
Non-hemorrhagic metalloproteinase that hydrolyzes the alpha chains of fibrinogen, as well as fibrin, fibronectin and casein. Beta and gamma chains are also hydrolyzed, but more slowly. Thrombolytic activity is also observed. Induces detachment of endothelial cells followed by death, and inhibits endothelial cell adhesion to fibronectin. Induces edema in mouse paw. Inhibits ADP-induced platelet aggregation on human platelet-rich plasma with an IC(50) of 2.8uM. Source: Recombinant protein corresponding to aa1-202 from Bothrops leucurus Snake venom metalloproteinase leucurolysin-A, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~30.5kD Amino Acid Sequence: QQFSPRYIELVVVADHGMFKKYNSNLNTIRKWVHEMLNTVNGFFRSMNVDASLVNLEVWSKKDLIKVEKDSSKTLTSFGEWRERDLLPRISHDHAQLLTVIFLDEETIGIAYTAGMCDLSQSVAVVMDHSKKNLRVAVTMAHELGHNLGMRHDGNQCHCNAPSCIMADTLSKGLSFEFSDCSQNQYQTYLTKHNPQCILNKP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 30.5
UniProt: P84907
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.