Snake Venom Serine Protease Catroxase-2, Recombinant, Crotalus atrox, aa25-258, His-Tag

Catalog Number: USB-586368
Article Name: Snake Venom Serine Protease Catroxase-2, Recombinant, Crotalus atrox, aa25-258, His-Tag
Biozol Catalog Number: USB-586368
Supplier Catalog Number: 586368
Alternative Catalog Number: USB-586368-20,USB-586368-100
Manufacturer: US Biological
Category: Molekularbiologie
Snake venom serine protease that may act in the hemostasis system of the prey. Source: Recombinant protein corresponding to aa25-258 from Crotalus atrox Snake venom serine protease catroxase-2, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~27.2kD Amino Acid Sequence: VVGGDECNINEHRSLVAIFNSTEFFCSGTLINQEWVVTAAHCDSTNFKMKLGVHSKKVPNEDEQTRNPKEKFFCPNKKKDDVLDKDIMLIKLDSPVSNSEHIAPLSLPSSPPSVGSVCHIMGWGSITPIEKTLPDVPYCANIKLLDDAVCQPPYPELPATSRTLCAGIPEGGKDTCGGDSGGPLICNGQFQGIVFYGAHPCGQALKPGVYTKVFDYNDWIQSIIAGNTAATCPP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 27.2
UniProt: Q8QHK2
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.