Sodium-dependent Phosphate Transport Protein 2B, Recombinant, Human, aa574-689, His-B2M-Tag
Biozol Catalog Number:
USB-586371
Supplier Catalog Number:
586371
Alternative Catalog Number:
USB-586371-20,USB-586371-100
Manufacturer:
US Biological
Category:
Molekularbiologie
May be involved in actively transporting phosphate into cells via Na(+) cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs alveoli. Source: Recombinant protein corresponding to aa574-689 from human Sodium-dependent phosphate transport protein 2B, fused to 6X His-B2M-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~27.1kD Amino Acid Sequence: LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted