Solute Carrier Family 2, Facilitated Glucose Transporter Member 1, Recombinant, Mouse, aa451-492
Biozol Catalog Number:
USB-586376
Supplier Catalog Number:
586376
Alternative Catalog Number:
USB-586376-20,USB-586376-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Facilitative glucose transporter, which is responsible for constitutive or basal glucose uptake. Has a very broad substrate specificity, can transport a wide range of aldoses including both pentoses and hexoses. Most important energy carrier of the brain: present at the blood-brain barrier and assures the energy-independent, facilitative transport of glucose into the brain. In association with BSG and NXNL1, promotes retinal cone survival by increasing glucose uptake into photoreceptors. Source: Recombinant protein corresponding to aa451-492 from mouse Solute carrier family 2, facilitated glucose transporter member 1, expressed in E.coli. Molecular Weight: ~4.5kD Amino Acid Sequence: KVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADSQV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted