Solute Carrier Organic Anion Transporter Family Member 2B1, Recombinant, Human, aa461-564, His-Tag

Product Overview

• Article Name: Solute Carrier Organic Anion Transporter Family Member 2B1, Recombinant, Human, aa461-564, His-Tag
• Biozol Catalog Number: USB-586378
• Supplier Catalog Number: 586378
• Alternative Catalog Number: USB-586378-20,USB-586378-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Mediates the Na(+)-independent transport of organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost. Source: Recombinant protein corresponding to aa461-564 from human Solute carrier organic anion transporter family member 2B1, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~13kD Amino Acid Sequence: FFIGCSSHQIAGITHQTSAHPGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCSCVVEGNPVLAGSCDSTCSHLVVPF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 13
• UniProt: O94956
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.