SPARC-related Modular Calcium-binding Protein 1, Recombinant, Human, aa277-382, His-GST-Tag

Product Overview

• Article Name: SPARC-related Modular Calcium-binding Protein 1, Recombinant, Human, aa277-382, His-GST-Tag
• Biozol Catalog Number: USB-586384
• Supplier Catalog Number: 586384
• Alternative Catalog Number: USB-586384-20,USB-586384-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Plays essential roles in both eye and limb development. Probable regulator of osteoblast differentiation. Source: Recombinant protein corresponding to aa277-382 from human SPARC-related modular calcium-binding protein 1, fused to 6X His-GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~43.2kD Amino Acid Sequence: GRPLPGTSTRYVMPSCESDARAKTTEADDPFKDRELPGCPEGKKMEFITSLLDALTTDMVQAINSAAPTGGGRFSEPDPSHTLEERVVHWYFSQLDSNSSNDINKR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 43.2
• UniProt: Q9H4F8
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.