Tenomodulin, Recombinant, Mouse, aa51-317, His-Tag

Catalog Number: USB-586469
Article Name: Tenomodulin, Recombinant, Mouse, aa51-317, His-Tag
Biozol Catalog Number: USB-586469
Supplier Catalog Number: 586469
Alternative Catalog Number: USB-586469-20, USB-586469-100
Manufacturer: US Biological
Category: Molekularbiologie
May be an angiogenesis inhibitor. Source: Recombinant protein corresponding to aa51-317 from mouse Tenomodulin, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~35.6kD Amino Acid Sequence: KHFWPEVSKKTYDMEHTFYSNGEKKKIYMEIDPITRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWINPTLIAVSELQDFEEDGEDLHFPTSEKKGIDQNEQWVVPQVKVEKTRHTRQASEEDLPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRVIMPCNWWVARMLGRV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 35.6
UniProt: Q9EP64
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.