Tetraacyldisaccharide 4-kinase, Recombinant, E. coli, aa1-328, His-Tag, Myc-Tag

Product Overview

• Article Name: Tetraacyldisaccharide 4-kinase, Recombinant, E. coli, aa1-328, His-Tag, Myc-Tag
• Biozol Catalog Number: USB-586477
• Supplier Catalog Number: 586477
• Alternative Catalog Number: USB-586477-20,USB-586477-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Transfers the gamma-phosphate of ATP to the 4-position of a tetraacyldisaccharide 1-phosphate intermediate (termed DS-1-P) to form tetraacyldisaccharide 1,4-bis-phosphate (lipid IVA). Source: Recombinant protein corresponding to aa1-328 from Escherichia coli Tetraacyldisaccharide 4-kinase, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~43.0kD Amino Acid Sequence: MIEKIWSGESPLWRLLLPLSWLYGLVSGAIRLCYKLKLKRAWRAPVPVVVVGNLTAGGNGKTPVVVWLVEQLQQRGIRVGVVSRGYGGKAESYPLLLSADTTTAQAGDEPVLIYQRTDAPVAVSPVRSDAVKAILAQHPDVQIIVTDDGLQHYRLARNVEIVVIDGVRRFGNGWWLPAGPMRERAGRLKSVDAVIVNGGVPRSGEIPMHLLPGQAVNLRTGTRCDVAQLEHVVAMAGIGHPPRFFATLKMCGVQPEKCVPLADHQSLNHADVSALVSAGQTLVMTEKDAVKCRAFAEENWWYLPVDAQLSGDEPAKLLTQLTLLASGN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 43
• UniProt: C4ZQ41
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.