Tetraspanin-2, Recombinant, Human, aa112-188, His-Tag

Catalog Number: USB-586480
Article Name: Tetraspanin-2, Recombinant, Human, aa112-188, His-Tag
Biozol Catalog Number: USB-586480
Supplier Catalog Number: 586480
Alternative Catalog Number: USB-586480-20, USB-586480-100
Manufacturer: US Biological
Category: Molekularbiologie
May play a role in signalling in oligodendrocytes in the early stages of their terminal differentiation into myelin-forming glia and may also function in stabilizing the mature sheath. Source: Recombinant protein corresponding to aa112-188 from human Tetraspanin-2, fused to 6X His-Tag at C-terminal, expressed in Yeast. Molecular Weight: ~9.5kD Amino Acid Sequence: GKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 9.5
UniProt: O60636
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.