Thrombin-like Enzyme Contortrixobin, Recombinant, Agkistrodon contortrix contortrix, aa1-234, His-Tag, Myc-Tag

Catalog Number: USB-586499
Article Name: Thrombin-like Enzyme Contortrixobin, Recombinant, Agkistrodon contortrix contortrix, aa1-234, His-Tag, Myc-Tag
Biozol Catalog Number: USB-586499
Supplier Catalog Number: 586499
Alternative Catalog Number: USB-586499-20, USB-586499-100
Manufacturer: US Biological
Category: Molekularbiologie
Thrombin-like snake venom serine protease that cleaves beta chain of fibrinogen (FGB), releasing fibrinopeptide B. Has a coagulant activity activating blood coagulation factors V (F5) and XIII (F13A1). Source: Recombinant protein corresponding to aa1-234 from Agkistrodon contortrix contortrix Thrombin-like enzyme contortrixobin, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~32.4kD Amino Acid Sequence: VVGGDECNINEHRFLVAIFNSNGFVCSGTLINQEWVLTAAHCDSTDFQIKLGAHSKKVLNEDEQIRNPKEKFICPNKKNDEVLDKDIMLIKLDSRVSNSEHIAPLSLPSSPPSVGSVCHIMGWGSITPIEVTFPDVPHCAYINLLDDAACQPGYPEVLPEYRTLCAGILEGGKDTCNYDSGGPLICNGQFQGIVSYGAHPCGQSLKPGIYTKVFDYNDWIQSIIAGNTAATCPP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 32.4
UniProt: P82981
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.