Thymosin Beta-10, Recombinant, Human, aa2-44, GST-Tag

Catalog Number: USB-586507
Article Name: Thymosin Beta-10, Recombinant, Human, aa2-44, GST-Tag
Biozol Catalog Number: USB-586507
Supplier Catalog Number: 586507
Alternative Catalog Number: USB-586507-20, USB-586507-100
Manufacturer: US Biological
Category: Molekularbiologie
Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization. Source: Recombinant protein corresponding to aa43-338 from human Thymosin beta-10, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~31.6kD Amino Acid Sequence: ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 31.6
UniProt: P63313
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.