Translational Regulator CsrA, Recombinant, E. coli, aa1-61, His-Tag
Biozol Catalog Number:
USB-586581
Supplier Catalog Number:
586581
Alternative Catalog Number:
USB-586581-20, USB-586581-100
Manufacturer:
US Biological
Category:
Molekularbiologie
A key translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Mediates global changes in gene expression, shifting from rapid growth to stress survival by linking envelope stress, the stringent response and the catabolite repression systems. Usually binds in the 5-UTR, binding at or near the Shine-Dalgarno sequence prevents ribosome-binding, repressing translation, binding elsewhere in the 5-UTR can activate translation and/or stabilize the mRNA. Its function is antagonized by small RNA(s). Source: Recombinant protein corresponding to aa1-61 from Escherichia coli Translational regulator CsrA, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~10.9kD Amino Acid Sequence: MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQQSSY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted