Translocated Intimin Receptor Tir, Recombinant, E. coli O157:H7, aa252-362, His-SUMO-Tag

Catalog Number: USB-586582
Article Name: Translocated Intimin Receptor Tir, Recombinant, E. coli O157:H7, aa252-362, His-SUMO-Tag
Biozol Catalog Number: USB-586582
Supplier Catalog Number: 586582
Alternative Catalog Number: USB-586582-20, USB-586582-100
Manufacturer: US Biological
Category: Molekularbiologie
Multifunctional protein that is required for efficient pedestal formation in host epithelial cells during infection. The extracellular region acts as a receptor for bacterial intimin, allowing the bacterium to attach tightly to the host-cell surface. Simultaneously, the intracellular region initiates a signaling cascade in the host cell, which leads to actin polymerization and formation of actin pedestals at the sites of bacterial adhesion. Source: Recombinant protein corresponding to aa252-362 from Escherichia coli O157:H7 Translocated intimin receptor Tir, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~27.8kD Amino Acid Sequence: QALALTPEPDSPTTTDPDAAASATETATRDQLTKEAFQNPDNQKVNIDELGNAIPSGVLKDDVVANIEEQAKAAGEEAKQQAIENNAQAQKKYDEQQAKRQEELKVSSGAG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 27.8
UniProt: C6UYL8
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.