Transposase insE for Insertion Sequence IS3A, Recombinant, E. coli, aa1-99, hFc-Tag

Product Overview

• Article Name: Transposase insE for Insertion Sequence IS3A, Recombinant, E. coli, aa1-99, hFc-Tag
• Biozol Catalog Number: USB-586593
• Supplier Catalog Number: 586593
• Alternative Catalog Number: USB-586593-20
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Involved in the transposition of the insertion sequence IS3. Source: Recombinant protein corresponding to aa1-99 from Escherichia coli Transposase insE for insertion sequence IS3A, fused to hFc-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~37.5kD Amino Acid Sequence: MTKTVSTSKKPRKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSSERELEMSTEIARLKRQLAERDEELAILQKAATYFAKRLK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 37.5
• UniProt: P0CF66
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.