Transthyretin, Recombinant, Mouse, aa23-147, His-Tag

Catalog Number: USB-586597
Article Name: Transthyretin, Recombinant, Mouse, aa23-147, His-Tag
Biozol Catalog Number: USB-586597
Supplier Catalog Number: 586597
Alternative Catalog Number: USB-586597-20
Manufacturer: US Biological
Category: Molekularbiologie
Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain. Source: Recombinant protein corresponding to aa23-147 from mouse Transthyretin, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.5kD Amino Acid Sequence: AGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 15.5
UniProt: P07309
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.