Tripeptidyl-peptidase 2, Recombinant, Mouse, aa44-264, His-Tag, Myc-Tag

Catalog Number: USB-586617
Article Name: Tripeptidyl-peptidase 2, Recombinant, Mouse, aa44-264, His-Tag, Myc-Tag
Biozol Catalog Number: USB-586617
Supplier Catalog Number: 586617
Alternative Catalog Number: USB-586617-20,USB-586617-100
Manufacturer: US Biological
Category: Molekularbiologie
Component of the proteolytic cascade acting downstream of the 26S proteasome in the ubiquitin-proteasome pathway. May be able to complement the 26S proteasome function to some extent under conditions in which the latter is inhibited. Stimulates adipogenesis. Source: Recombinant protein corresponding to aa44-264 from mouse Tripeptidyl-peptidase 2, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~29.5kD Amino Acid Sequence: DTGVDPGAPGMQVTTDGKPKIIDIIDTTGSGDVNTATEVEPKDGEIIGLSGRVLKIPANWTNPLGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPIHRVALAEACRKQEEFDIANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGETWRACVDSNENGDLSKCAVLRNYKEAQEYSSFGTAEMLNYSVNIYDDGNLLSIVTSGGAH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 29.5
UniProt: Q64514
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.