Truncated Plaque-size/host Range Protein, Recombinant, Vaccinia virus, aa18-92, MBP-Tag, His-Tag
Biozol Catalog Number:
USB-586639
Supplier Catalog Number:
586639
Alternative Catalog Number:
USB-586639-20
Manufacturer:
US Biological
Category:
Molekularbiologie
Regulation of plaque size and host range. In this strain the truncated ps/hr protein is probably not functional. Source: Recombinant protein corresponding to aa18-92 from Vaccinia virus Truncated plaque-size/host range protein, fused to MBP-Tag at N-terminal and 6X His-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~52.6kD Amino Acid Sequence: YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted