Tumor Necrosis Factor Ligand Superfamily Member 4, Recombinant, Rabbit, aa45-187, His-Tag, Myc-Tag

Catalog Number: USB-586660
Article Name: Tumor Necrosis Factor Ligand Superfamily Member 4, Recombinant, Rabbit, aa45-187, His-Tag, Myc-Tag
Biozol Catalog Number: USB-586660
Supplier Catalog Number: 586660
Alternative Catalog Number: USB-586660-20
Manufacturer: US Biological
Category: Molekularbiologie
Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production. Source: Recombinant protein corresponding to aa45-187 from rabbit Tumor necrosis factor ligand superfamily member 4, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~19.9kD Amino Acid Sequence: QHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 19.9
UniProt: O02765
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.