Tumor Necrosis Factor Receptor Superfamily Member 17, Recombinant, Human, aa1-54, His-Tag, Myc-Tag

Catalog Number: USB-586665
Article Name: Tumor Necrosis Factor Receptor Superfamily Member 17, Recombinant, Human, aa1-54, His-Tag, Myc-Tag
Biozol Catalog Number: USB-586665
Supplier Catalog Number: 586665
Alternative Catalog Number: USB-586665-20,USB-586665-100
Manufacturer: US Biological
Category: Molekularbiologie
Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK. Source: Recombinant protein corresponding to aa1-54 from human Tumor necrosis factor receptor superfamily member 17, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~10.9kD Amino Acid Sequence: MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 10.9
UniProt: Q02223
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.