Tumor Necrosis Factor Receptor Superfamily Member 4, Recombinant, Mouse, aa20-211, His-SUMO-Tag

Catalog Number: USB-586670
Article Name: Tumor Necrosis Factor Receptor Superfamily Member 4, Recombinant, Mouse, aa20-211, His-SUMO-Tag
Biozol Catalog Number: USB-586670
Supplier Catalog Number: 586670
Alternative Catalog Number: USB-586670-20,USB-586670-100
Manufacturer: US Biological
Category: Molekularbiologie
Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity (By similarity). Source: Recombinant protein corresponding to aa20-211 from mouse Tumor necrosis factor receptor superfamily member 4, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~37.3kD Amino Acid Sequence: VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 37.3
UniProt: P47741
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.