Type III Export Protein PscF, Recombinant, Pseudomonas aeruginosa, aa2-85, His-Tag, Myc-Tag

Product Overview

• Article Name: Type III Export Protein PscF, Recombinant, Pseudomonas aeruginosa, aa2-85, His-Tag, Myc-Tag
• Biozol Catalog Number: USB-586680
• Supplier Catalog Number: 586680
• Alternative Catalog Number: USB-586680-20,USB-586680-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Major component of the type III secretion needle structure. Required for cytotoxicity on macrophages. Source: Recombinant protein corresponding to aa2-85 from Pseudomonas aeruginosa Type III export protein PscF, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~16.6kD Amino Acid Sequence: AQIFNPNPGNTLDTVANALKEQANAANKDVNDAIKALQGTDNADNPALLAELQHKINKWSVIYNINSTVTRALRDLMQGILQKI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 16.6
• UniProt: P95434
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.