Uncharacterized Protein UL128, Recombinant, Human cytomegalovirus, aa1-171
Biozol Catalog Number:
USB-586726
Supplier Catalog Number:
586726
Alternative Catalog Number:
USB-586726-20, USB-586726-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Plays a role in viral entry into host cells. Forms a pentameric complex at the surface of the viral envelope together with gH, gL, UL130 and UL131. This complex is required for entry in epithelial, endothelial and myeloid host cells. Mechanistically, engages host receptor(s) including neurophilin 2/NRP2 to mediate infection. Additionally, monomeric UL128 may interfere with certain inflammatory cytokines to increase infection and dissemination by blocking monocytes migration. Source: Recombinant protein corresponding to aa1-171 from Human cytomegalovirus Uncharacterized protein UL128, expressed in Yeast. Molecular Weight: ~19.7kD Amino Acid Sequence: MSPKDLTPFLTTLWLLLGHSRVPRVRAEECCEFINVNHPPERCYDFKMCNRFTVALRCPDGEVCYSPEKTAEIRGIVTTMTHSLTRQVVHNKLTSCNYNPLYLEADGRIRCGKVNDKAQYLLGAAGSVPYRWINLEYDKITRIVGLDQYLESVKKHKRLDVCRAKMGYMLQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted