Uncharacterized Protein yjbL, Recombinant, E. coli, aa1-84, His-KSI-Tag

Catalog Number: USB-586728
Article Name: Uncharacterized Protein yjbL, Recombinant, E. coli, aa1-84, His-KSI-Tag
Biozol Catalog Number: USB-586728
Supplier Catalog Number: 586728
Alternative Catalog Number: USB-586728-20, USB-586728-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa1-84 from Escherichia coli Uncharacterized protein yjbL, fused to 6X His-KSI-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~25.1kD Amino Acid Sequence: MLKIIPGATGYFNKTLNSNQFDNEDAIKDKLDNRGSIKGKLNNIYGKSIDYAALRHRDIIIAKIDLFIQRITHNLWHARKKMCF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 25.1
UniProt: P32693
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.