Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis Partial recombinant protein corresponding to aa143-288 from human Basic Fibroblast Growth Factor, expressed in E. coli. Molecular Weight: ~16.5kD Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 0.05ng/ml, corresponding to a specific activity of >2.0*107IU/mg. Amino Acid Sequence: M+PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 150mM sodium chloride, pH 7.6. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted
