Basic Leucine Zipper and W2 Domain-containing Protein 2, Active, Recombinant, Human, GST-Tag, aa1-419 (BZW2)
Biozol Catalog Number:
USB-586840
Supplier Catalog Number:
586840
Alternative Catalog Number:
USB-586840-20,USB-586840-100
Manufacturer:
US Biological
Category:
Molekularbiologie
May be involved in neuronal differentiation. Recombinant protein corresponding to aa1-419 from Basic leucine zipper and W2 domain-containing protein 2, fused to GST-Tag at N-terminal, exoressed in E.coli. Molecular Weight: ~75.2kD Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized OMA1 at 5µg/ml can bind human BZW2, the EC50 of human BZM2 is 45.42-72.22ug/ml. Amino Acid Sequence: MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYCYDNIHFMKAFQKIVVLFYKADVLSEEAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESEGEEN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.