C-X-C Motif Chemokine 10, Active, Recombinant, Human, aa22-98 (CXCL10)

Catalog Number: USB-586849
Article Name: C-X-C Motif Chemokine 10, Active, Recombinant, Human, aa22-98 (CXCL10)
Biozol Catalog Number: USB-586849
Supplier Catalog Number: 586849
Alternative Catalog Number: USB-586849-10,USB-586849-50
Manufacturer: US Biological
Category: Molekularbiologie
Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3 Recombinant protein corresponding to aa22-98 from human C-X-C motif chemokine 10 expressed in E. coli. Molecular Weight: ~8.6kD Biological Activity: The ED50 as determined by its ability to chemoattract human CXCR3 transfected BaF3 mouse proB cells is typically 0.02-0.06ug/ml. Amino Acid Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 8.6
UniProt: P02778
Purity: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Form: Supplied as a lyophilized powder from PBS, pH 7.0. Reconstitute with sterile ddH2O, to a concentration of 0.1-1mg/ml.