C-X-C motif chemokine 5, Active, Recombinant, Human, aa44-114 (CXCL5)

Catalog Number: USB-586853
Article Name: C-X-C motif chemokine 5, Active, Recombinant, Human, aa44-114 (CXCL5)
Biozol Catalog Number: USB-586853
Supplier Catalog Number: 586853
Alternative Catalog Number: USB-586853-10,USB-586853-50
Manufacturer: US Biological
Category: Molekularbiologie
Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes. Partial Recombinant protein corresponding to aa44-114 from Human C-X-C motif chemokine 5, expressed in E. coli. Molecular Weight: ~7.95kD Biological Activity: The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is less than 15ng/ml. Amino Acid Sequence: LRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 7.95
UniProt: P42830
Purity: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Form: Supplied as a lyophilized powder from 20mM PBS, pH 6.0. Reconstitute with sterile ddH2O, to a concentration of 0.1-1mg/ml.