Carbonic A 5B, Mitochondrial, Active, Recombinant, Human, His-Tag, aa34-317 (CA5B)

Catalog Number: USB-586854
Article Name: Carbonic A 5B, Mitochondrial, Active, Recombinant, Human, His-Tag, aa34-317 (CA5B)
Biozol Catalog Number: USB-586854
Supplier Catalog Number: 586854
Alternative Catalog Number: USB-586854-10,USB-586854-50
Manufacturer: US Biological
Category: Molekularbiologie
Reversible hydration of carbon dioxide. Recombinant protein corresponding to aa34-317 from human Carbonic anhydrase 5B, fused to 6xHis-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~33.77kD Biological Activity: The esterase activity is determined to be greater than 1000pmol/min/ug. Amino Acid Sequence: CSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 33.77
UniProt: Q9Y2D0
Purity: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, pH 8, 100mM sodium chloride. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.