Carbonic Anhydrase-related Protein, Active, Recombinant, Human, His-Tag, aa2-290 (CA8)

Catalog Number: USB-586860
Article Name: Carbonic Anhydrase-related Protein, Active, Recombinant, Human, His-Tag, aa2-290 (CA8)
Biozol Catalog Number: USB-586860
Supplier Catalog Number: 586860
Alternative Catalog Number: USB-586860-10,USB-586860-50
Manufacturer: US Biological
Category: Molekularbiologie
Does not have a carbonic anhydrase catalytic activity. Partial recombinant protein corresponding to aa2-290 from human Carbonic anhydrase-related protein, fused to 6xHis-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~34.04kD Biological Activity: The esterase activity is determined to be is 162.5 pmol/min/µg. Amino Acid Sequence: ADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 34.04
UniProt: P35219
Purity: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, pH 8.5, 500mM sodium chloride, 1mM DTT.