Fibroblast Growth Factor 1, Active, Recombinant, Mouse, aa16-155 (Fgf1)

Catalog Number: USB-586882
Article Name: Fibroblast Growth Factor 1, Active, Recombinant, Mouse, aa16-155 (Fgf1)
Biozol Catalog Number: USB-586882
Supplier Catalog Number: 586882
Alternative Catalog Number: USB-586882-10,USB-586882-50
Manufacturer: US Biological
Category: Molekularbiologie
Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrin ITGAV Recombinant protein corresponding to aa16-155 from mouse Fibroblast growth factor 1, expressed in E.coli. Molecular Weight: ~15.7kD Biological Activity: The ED50 as determined by the dose-dependent stimulation of thymidine uptake by 3T3 cells in the presence of Heparin is less than 1.6ng/ml. Amino Acid Sequence: FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 15.7
UniProt: P61148
Purity: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, pH 6.6, 500mM sodium chloride. Reconstitute with sterile ddH2O, to a concentration of 0.1-1mg/ml.