Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. Recombinant protein corresponding to aa18-141 from mouse Granulocyte-macrophage colony-stimulating factor, fused to 6X His-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~15.1kD Biological Activity: The ED50 as determined in a cell proliferation assay using PDC-P1 cells is less than 100pg/ml. Amino Acid Sequence: APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
