Recombinant protein corresponding to aa22-299 from Helicobacter pylori Putative peptidyl-prolyl cis-trans isomerase, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~28.8kD vBiological Activity: TheMeasured by its binding ability in a functional ELISA. Immobilized yuaB at 5ug/ml can bind human HP_0175 with a linear range of 31.25-600.00ng/ml. Amino Acid Sequence: KPAHNANNATHNTKKTTDSSAGVLATVDGRPITKSDFDMIKQRNPNFDFDKLKEKEKEALIDQAIRTALVENEAKTEKLDSTPEFKAMMEAVKKQALVEFWAKKQAEEVKKVQIPEKEMQDFYNANKDQLFVKQEAHARHILVKTEDEAKRIISEIDKQPKAKKEAKFIELANRDTIDPNSKNAQNGGDLGKFQKNQMAPDFSKAAFALTPGDYTKTPVKTEFGYHIIYLISKDSPVTYTYEQAKPTIKGMLQEKLFQERMNQRIEELRKHAKIVINK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
