Immunoglobulin Heavy Constant Gamma 1, Active, Recombinant, Human, aa104-330 (IGHG1)
Biozol Catalog Number:
USB-586920
Supplier Catalog Number:
586920
Alternative Catalog Number:
USB-586920-10, USB-586920-50
Manufacturer:
US Biological
Category:
Molekularbiologie
Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens Partial recombinant protein corresponding to aa104-330 from human Immunoglobulin heavy constant gamma 1, expressed in Mammalian cells. Molecular Weight: ~25.9kD Biological Activity: The ED50 as determined by its ability to bind Human FCGR3A in functional ELISA is less than 10ug/ml. Amino Acid Sequence: DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
