Inhibin beta C Chain, Active, Recombinant, Human, His-Tag, aa237-352 (INHBC)

Catalog Number: USB-586923
Article Name: Inhibin beta C Chain, Active, Recombinant, Human, His-Tag, aa237-352 (INHBC)
Biozol Catalog Number: USB-586923
Supplier Catalog Number: 586923
Alternative Catalog Number: USB-586923-10, USB-586923-50
Manufacturer: US Biological
Category: Molekularbiologie
Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins. Recombinant protein corresponding to aa237-352 from human Inhibin beta C chain, fused to 6xHis-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~14.83kD Biological Activity: The ED50 as determined by its ability to bind Human Activin RIIA in functional ELISA is less than 20ug/ml. Amino Acid Sequence: GIDCQGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 14.83
UniProt: P55103
Purity: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Form: Supplied as a lyophilized powder from 4mM HCl, 1mM DTT.