Interleukin-1 Receptor Antagonist Protein, Active, Recombinant, Human, aa26-177 (IL1RN)

Catalog Number: USB-586941
Article Name: Interleukin-1 Receptor Antagonist Protein, Active, Recombinant, Human, aa26-177 (IL1RN)
Biozol Catalog Number: USB-586941
Supplier Catalog Number: 586941
Alternative Catalog Number: USB-586941-10, USB-586941-50
Manufacturer: US Biological
Category: Molekularbiologie
Inhibits the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling. Has no interleukin-1 like activity. Binds functional interleukin-1 receptor IL1R1 with greater affinity than decoy receptor IL1R2, however, the physiological relevance of the latter association is unsure. Recombinant protein corresponding to aa26-177 from human Interleukin1 receptor antagonist protein, expressed in E. coli. Molecular Weight: ~17.26kD Biological Activity: The ED50 as determined by the dose-dependent inhibition of IL-1 stimulation of D10S cells is typically 0.5ng/ml Amino Acid Sequence: RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 17.26
UniProt: P18510
Purity: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Form: Supplied as a lyophilized powder from 50mM Tris-HCl, pH 7.5, 0.2M sodium chloride. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.