Interleukin-10, Active, Recombinant, Mouse, aa19-178 (Il10)

Catalog Number: USB-586943
Article Name: Interleukin-10, Active, Recombinant, Mouse, aa19-178 (Il10)
Biozol Catalog Number: USB-586943
Supplier Catalog Number: 586943
Alternative Catalog Number: USB-586943-10,USB-586943-50
Manufacturer: US Biological
Category: Molekularbiologie
Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells. Recombinant protein corresponding to aa19-178 from mouse Interleukin 10, expressed in E. coli. Molecular Weight: ~18.9kD Biological Activity: The ED50 as determined by the dose-dependent co-stimulation with murine IL-4 of MC-9 cells is less than 2ng/ml. Amino Acid Sequence: SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 18.9
UniProt: P18893
Purity: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Form: Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1.0mg/ml.